Property | Value |
dbkwik:wackypedia/property/wikiPageUsesTemplate | |
is dbkwik:wackypedia/property/wikiPageUsesTemplate of | - Pirates
- Curses
- Templates
- Wow! If you're still reading your attention span far outstrips mine; I would of stopped reading ages back, and I have (therefore I'm not here anymore)
- Broadcasting
- Bodily fluids
- Star Trek
- Schizophrenic
- People who will kill your cat
- Interviews
- Can't go wrong
- IllogiGames
- Demons
- People who are God
- Lightly braised
- Places
- Articles that bleed black when poked with a nuclear warhead
- People who may or may not be the Goatse Guy
- Things
- Animals
- Booby prizes
- Organizations
- Things that will eat you
- Repetitive
- People deemed bloody insane by an independent panel of people smarter than you
- You
- Death
- Onomatopœias
- Locations
- People
- Morbid
- Conspiracies
- Causes of cancer
- Food
- Writing
- Pies
- Education
- Epic Fail
- Toilets
- Body parts
- !
- Randumb
- Procrastination
- Gangsters
- IRC
- Men
- Fish
- !!
- Stuff
- Articles with really long titles
- Arguments
- Mental
- Adhesive tape
- Japanese
- Vegetables
- Sounds
- Culture
- Video games
- Nonsense
- Stupid
- Figments of your imagination
- The Internet Epic Course
- Frogs
- Ramble
- Aliens
- Mythical creatures
- Religion
- Cities
- Songs
- Jokes
- Insane
- Interballistic pissiles
- Phyllis Hyman
- Sex
- Weapons
- Disappointing
- School
- Crime
- Information
- Did you know?
- Magical
- LOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOONG
- Typography
- Ninjas
- NASCAR
- Spleens
- Koalas
- Rodents
- Simpsons references
- Facts
- The Truth
- Sports
- Time
- Nazis
- Leet
- Uber
- Inside jokes
- Loco
- Illogic Book
- Names
- Singers
- Evil
- Lists
- IPs
- Pop Culture
- Time travel
- Television channels in the United Kingdom
- Materials
- Dance
- Mad
- Ambiguous
- Hard
- Illogicopedia (The Game)
- Afflictions
- Diseases
- Wait, wut?
- Phyllogicopedia
- Sleep
- Turnips
- Obscure Zork references
- Languages
- IllogiBooks
- Kind of trails off towards the end
- Not US Presidents
- Oh noes!
- Things Dealing with Spoons
- Department of Limelight
- Strange
- Very random stoof, not to be dinged with
- Towns in the United Kingdom
- Legends
- Provinces and territories of Canada
- Origins
- Hyper
- Contests
- Life
- Disturbing
- Exclamations
- Shiny
- WackyHistory
- Weather
- Lame 'n' Literal
- Christmas
- Misconceptions
- Attacks
- Symbols
- Oom
- Health
- Bagel
- People whose surname is now "Who?"
- I dunno lol
- AYNTKO
- Articles that are trying to point out to you that it is time to go away
- Like
- Racism
- Advisory templates
- Drew back the curtains AHHHHHHHHHHHHHHHHHHH!
- Batman
- Deer in the headlights
- Psychology
- TLDR
- Thwart The Vandals
- Nature
- Indiana Jones
- Headwear
- Threes
- One-letter pages
- Uncyclopedia
- Schools
- Threesomes
- Writers
- Finance
- Homestar Runner
- Classical musicians
- Critique on modern society
- Pickles
- Strange but compelling
- Quizes
- Demented
- Britain
- Biology
- Things that are like a box of chocolates
- Evil Clone Articles
- Short 'n' sweet
- Gourmets
- Ceremoniously hugged users
- Kings
- Urban legends
- Shoop da woop
- Agents
- Controversy
- Pants
- Utterly and mentally butterly
- Charley says
- Cortex
- Shameless puns
- Robots
- Humans
- Chinese television programmes
- 1980s
- Articles that are completely unrelated to their title. The title being slightly annoying in the way that it's here to stay, *shakes fist*
- Articles based off of Family Guy gags
- Wishful thinking
- Heartwarming
- Family Guy
- Grapefruit
- Loops
- Free range articles
- Pages That Have Been Graced By MrMetalFlower In a Category-Making Mood
- Houses
- Love
- Swenglish-afflicted
- Rainbows
- Breakfast
- Galactic Congress
- Furniture
- Months
- Mythology
- Say whut?
- Eric. Is. BananaMan!
- Things made up in school one day
- Enchanter
- Entities for whom Quotes are Made
- Tough diplomacy
- Ambiguation
- Anyone I've ever met
- Alive
- Yuppie barnacles
- BLOBBY!
- Oppression
- Commerce
- Canadian
- Directions
- Badly translated yet not lacking in appeal
- Pour me some more pink pickles
- Cereal
- Irish
- Psychic Babble
- Mood
- By golly
- Articles that are so unadulteratedly long that they've warranted this nowhere equally long, yet still lengthly, waste of a category.
- Colbert Nation television people
- Concepts
- Debates
- Artists
- Friendly
- Public Service Announcements
- Articles created by those with inflated heads
- Geography
- Et tu, Brute?
- Broken
- Dupree
- Olympics
- Insults
- Phorum
- Wipe it up
- Behind The Hatred
- Lab escapees
- Metals
- Articulartastic Ministry for Articles
- Quit yo' jabberin, foo!
- Competitions
- Missing in action
- Randomly Grouped Pages
- Stickied threads
- Users Who Enjoy an Excessive Number of Categories just for the heck of it
- What!!!
- Illogicast
- Articulartastic Ministry for Articles/Request
- Articles written by a tired person
- Hmm, indeed
- Fair Use images
- Catherines
- Phyllis Hyman auf Deutsch
- Users who can shoot lazers from their armpits
- Articles about homosexual crotchless underwear
- André Bretonizms
- Users that MNIHDOAIHDOD
- Alicia Keezizms
- Hymenizms
- What?
- Idle threats
- The Battle
- Countries
- Days
- Canada
- Invasion of Illogiland
- Magic
- Women
- Extraterrestrial phenomena
- Forbidden
- Senses
- !!!
- Quotes
- Anime
- Transportation
- Category
- Eh?
- Music
- Car manufacturers
- Phyllises
- Politics
- Actors
- Words
- Clothing
- Fruit
- Shock sites
- Stories
- Random mashing of the keyboard
- Technology
- Poetry
- Scary
- Dumb
- Moved from The Hidden Dictionary
- Stating the obvious
- Fake cheats
- 'Holy Mackeral Mister!' That's right Jimmy, it's me, Dodgeball All Star Patches O. Hoolihan
- Television
- Articles in which the author seems to have replaced some/all imagination with noun, randomcraziness, verb templates etc. I grow weary of it
- Phyllis Hymanizms
- Illogicopedians that, because of a small virtual award, have now gained the ability to be even more awesome aswell as the ability to fly etc. Yay!
- Articles made of sour krout, churned with squirrel's nuts (which kind eh? :P) and baked in a carpet bomb.
- Articles that I can't think of a category for
- Shit
- Tamia trash
- Help
- You suck
- Science
- Puns
- Cats
- Crap
- Articles with lots of categories
- Illogical Zone
- Articles in which the author freely admits having little or no inspiration during writing it, infuriating isn't it?
- Lepers
- Internet
- My backspace bra is brokne
- Ha ha... geddit?
- Locigal
- Subliminal messaging
- Anti-cheese
- Rants
- Good
- Articles with way too much categories
- Random
- Articles with so many categories the categories stating that this article has too many categories became redundant, warranting the need of this badly grammared and redundant category. The horror, the horror.
- Fishy
- Spam
- Awesome
- Musicians
- Cheese
- This is an irrelevant category. Or is it?
- A category that contains nothing but articles that contain certain things
- Lol
- Heh heh
- Locations in the United States
- Google
- Geology
- Inventions
- Breakfast cereal
- Websites
- Numbers
- Wikis
- Gibberish
- Law
- Microsoft
- Moons
- Twisted
- False
- Goat
- Physics
- Computing
- Space
- Wikipedia
- History
- Films
- Subbuteo
- Mongol Empire
- Threats to your computer
- Medicine
- Nothing
- Boring
- Cool
- Madness
- Quests
- Hardware
- Hot
- Organisations
- Comedians
- MY CAPS LOCK BUTTON IS BROKEN
- Fire
- Cartoons
- States of being
- Economics
- Monkeys
- Years
- Creatures
- Deities
- Monsters
- Weird
- Theories
- Articles where you get shot in the back of de head
- Tennis
- Articles that were written by a person out of his mind
- Illogian television programmes
- Employment
- Spooned from Wikipedia
- Sequels
- Thanks for letting me know that
- Articles written by a devout racist (HelloolleH)
- Organs
- BURNING!
- Frobbed
- Too quiet
- Articles that make reference to video games that no one has ever heard of
- Ye ye ye ne sheet ze feek eep
- Ha ha ha that was funny DEAD?!
- Drum tablature
- References to 28 Days Later
- I'm in a rus
- Theologists
- This is the dawning of the Age Of Aquarius
- Users who aren't computer users but were instead accused of being a user by their ex-partner
- Gay User
- Cursed Users
- Batstuff
- Elmo stunt doubles
- Link templates
- Users who just left the room and then had one category added to their userpage, hahaha, oh the subterfuge
- Pioneering category
- Unimportant as yet
- Suspected sockpuppets
- Sockpuppets
- Organisms
- Msipeeled
- The Conspiracy
- Treats
- Articles
- Electrical goods
- ?
- Pears for Review
- True
- Advertising
- Correspondance
- Sane
- Anatomy
- Spooned
- Illogical
- Questions
- Interesting
- Colours
- Insects
- Isms
- IllogiGames:Illogiworld
- Articles about LOL
- Cutlery
- Moved From Uncyclopedia
- Current events
- French
- English
- Poets
- Shocking
- School work
- Articles that adhere to stereotypical conventions
- Not a category
- I wrote an article, yay!
- Lame 'n' Liberal
- I see nothing but discs of blue ray
- Cardiac Arrest
- Reviewed
- Users that are dicks when drunk
- Behind the Feathers
- Users who like to repeatedly press the Big Button
- Users that have fast food-based categories
- Permanent fashions
- ...hello? Anybody there?
- Outlaws
- User images
- Users that have a really long category on their user page, wow it's sooooo long huh? yeah I think so. anyway bye because this is boring.
- !!!!!
- Infobox templates
- Banned users
- Shapes
- Archives
- Eggs
- War
- People with unfortunate names
- Spoilers
- Elements
- India
- Amphibians
- Gods
- Recipes
- White rabbit conspiracy
- Eating behaviours
- Annoying
- Classification of the Receding Hairline
- Stereotypes
- Plants
- Socialist Wikipedians
- And
- Illogicopedia announcements
- Lolwut?
- Repetitive/low
- Bodily functions
- Exits
- Movies
- Dead
- Chickens
- Things That Will Eat Your Unborn Baby
- Fat people
- Machines
- Sayings
- Does exactly what it says on the tin
- Dogs
- One of those articles that is in fact a glorified conversation
- Celebrities
- A Subbuteoan Mystery
- Koala Quest
- Mathematics
- Predicament
- Toilet humour
- Bands
- Literature
- Agriculture
- Irony
- Philosophy
- I HAS A BUCKET (of parsnips)
- Games
- Speech
- Vanity
- British
- German
- Misleading
- Groups
- States
- WhyTo
- Superheroes
- Mutants
- British television programmes
- Superman
- Chocolate
- Humour
- WTF
- Money
- Powerful people
- Albums
- Things about The End and also things that pertain to the End, as well as events before or after the End
- Drugs
- Small Brrother
- Wikia
- Mountains
- Disgusting
- Cannibals
- Surrealism
- Rubbish
- Bananas
- TAKE ANYTHING U WHANT
- Crazy
- Texas
- Long
- The Worst
- Articles without a Java7837 quote
- Islands
- Scientology
- Incoherent rambling
- Incoherent
- Politicians
- The Murder Mystery
- Articles in which people have been taunted
- Big Brrother
- Actual Phyllis Hyman quotes
- Cons
- Drink
- 10 Reasons Why
- Society
- Psycho
- The Justice Chaps
- Star Wars
- Media
- Parodies
- Alternate dimensions
- Journey Of No Return
- Not
- Ducks
- Disney Places
- Fear Arousing Hallowe'en Fables
- Retro pages
- Religious people
- Washing powder
- Utensils
- Composite pages
- Liquids
- Kate Susan
- Backwards
- Communication
- Depersonalized
- Asplosions
- American football
- Cars
- American television programs
- Martial arts
- Sad
- I swear he was on fire
- Randjum
- Oral
- British culture
- Scientists
- United Kingdom
- Not epic
- Forces we cannot even imagine to understand
- Universal Overlords
- Fluff
- Esoteric
- Vague
- Ultraheroes
- Statistics
- Oh yeah
- Boobage
- Brain dead
- Babelfish
- Blah
- Things up inside you, finding entrance where they can
- Articles That Can't Seem To Stop Red-Linking Celebrities
- Formatting templates
- Television people
- Users who love NACHOS!
- The Administrator's League
- Television in the United Kingdom
- Candidates for Limelight/Votes
- Communist Party
- Self-published GNU images
- AID
- ( . )( . )
- BA jIBBLE pARTY Members
- Deleted articles
- Wikihow
- Users with doubts about the unfounded claims of the Big Bang theory
- Everything
- Candidates for Limelight
- Screenshots
- Users who are cooler than most, but not cool enough to be admins (like John the Baptist)
- Mad Libs templates
- Articulartastic Ministry for Articles/Delete
- Image copyright tags
- Users who thought Hindleyite was pronounced "hind-el-yite"
- BehindThe
- Users who claim they are not addicted to categories but clearly are
- Drug seller
- Naive
- Evicted from the Big Brrother hoose
- Users by status
- Non-free television screenshots
- People with fetishes
- Currency
- Work of George Hamburg
- Conversations
- Trees
- Things that are God
- Euro
- Arachnids
- Birds
- SdrawkcaB
- Lolwut
- Horr
- Txt Sp33k
- Pages that have been graced by one of those "cool and sexy admin" IPs while hitting Random Page
- Snork
- Fungi
- Doctors
- Threats
- God knows
- Memes
- Disability
- OMG OMG OMG
- Pages That Justify The "Dun-Dun-Dunnn!!" Noise
- Awesomely insane philosophies
- Rabbits
- Eyewear
- Sporks
- Television Broadcasting Stations
- Geometry
- Accountant's Quest
- Time bomb
- Soccer
- Dangerous
- Art
- Television channels
- Childish
- Signs the Rapture is Coming (Unto Thine Face)
- Errors
- Propaganda
- Chemistry
- Swedish
- Explanations
- Iridescent Purrings
- NATO members
- Fashion
- Battles
- Pǝddılɟ
- Hair
- The Rain of Dead Cats
- Deutsch
- Soccer teams
- Inquisitive
- The Sir Eiffel Games Series
- Internet browsers
- Retail
- Gory cats
- N00bs
- Article management
- Motorsports
- Beverages
- Brands of Asian chicken
- Restaurants
- Cookies
- I am insane
- Flub Nugget
- The Circus of Doom
- Porn
- Weeaboo
- Your family
- Articles written by a babbling idiot
- Articles caused by authors who smoke crack
- Truth
- POWER!
- Stationery
- Holidays
- Tools
- Um... can you repeat the question?
- British television people
- Shakespeare
- Water
- Drinks
- Botany
- Stubs
- Toys
- Camelids
- Suck
- Gay
- Meh
- Planets
- Astronomy
- Not food
- Social Darwinism
- Sweeeeeet carolina DUN DUN DUN
- The talk of the ghost town
- Answers
- Infantile
- Cheesy
- Basketball
- AH HA?
- Encyclopedia Dramatica
- Italian
- Censored pages
- Sherb
- The writing on the wall
- Inane
- US Presidents
- Microsoft Paint gallery
- Chinglish
- The Beatles
- Great Moments in History
- People named Josh
- Baldness caused by builder music
- Sacrilegious
- Slavery
- I'll just put the cat out... ARRRRRRRRRRRGGGHHHHHHH!
- Old
- Philias
- Buildings
- Moo
- Tasteless
- Articles that waste no time in degenerating into toilet humour
- Interjections
- Farmers
- Link whore articles
- Borat
- Soccer players
- Cakes
- Articles that were written by people born yesterday
- Forums
- Greetings
- Offensive
- Franglais?
- Top Gear
- Genius
- EEEOOO
- Shake it like a Polaroid picture
- Definitely not some word I just made up
- United States
- Things that go Boom
- Romanian articles
- Things that involve crotch-thrusting in the traditional far east
- Baseball
- Toxic
- Harry Potter
- Burgers
- Articles that stare up at the stars and dream of something more
- Roman emperors
- Uh oh
- Carbon based beans
- It works in base 13
- References to The Hitchhiker's Guide to the Galaxy
- Elite
- Anti-communism
- You, me and Dupree
- Threats to your grandmother
- France
- Bonkers
- Postal
- Mr Luver Luver
- IllogiHistory
- Addictions
- Decades
- Solid waste that isn't solid
- "Where" Games
- Users who are members of the Order of the Paperclip, Third Class
- Bad puns
- Users who refuse to participate in the too many categories war
- Unclassified
- Hardcore fans of the Telletubbies
- Root of all toothe rot; oh yeah, and evil
- Pages Without Enough Images
- User
- Users that got blocked
- Users that are part of the Communist-Atheist Conspiracy
- I like pie
- Articles fussed over by bleeding-heart pedants
- Apathy In Action
- I'll ask the questions here contestants
- Users who were taken away to the mental hospital for fanaticly adding categories to their user page
- Super
- Alliteration
- Great articles
- Garments
- Emails
- Sociology
- Footwear
- Businessmen
- Mammals
- Phrases
- Software
- Definitions
- Videos
- I think i will die from reading this article
- Appliances
- Sexual innuendo
- Punctuation
- Well-polished
- Acronyms
- ...
- Penguins
- Spooned From Uncyclopedia
- Rated PG
- PUKKA!!!
- IllogiGeo
- IllogiZoo
- Repetitive/high
- Verbal diarrhea
- Users who have the ability to fly
- Users who, ironically, after adding hundreds of categories, then have thousands more added by vandals
- Candidates for Limelight/Queued
- Users that wipe their fish
- Users who were smart-ass enough to make a sockpuppet account to vandalise and then got blocked and admitted it was them who did it
- Wotsits
- In charge during the catastrophe
- Users of whom it is decided that eggs suck
- Copyrighted free use images
- American users
- Articles that contradict other articles
- Graphics
- Illogicopedians from the United Kingdom
- Main page templates
- Users who may or may not be lurking outside your house in the hope you'll, at some point, have to go outside and therefore talk to them
- Insert Category Here
- Users whose name is not an anagram of "Josef Stalin"
- Yrogetac
- Stuffy
- Pyromania
- Stolen from QI
- Paranoid
- Hamumu Software
- Elusive
- Towns
- Contradictions
- Fun
- Phnoodle
- Oh no she didn't!
- Um... Yar
- Well slap my knee and call me Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
- SHOOT MY DONKEY ON THE SIDE
- Not Rated PG
- Randumb bursts of text. Works for me though.
- Smelly
- Eep!
- Networking
- Computers
- Gordon Bennett
- Surreal
- Treason
- Mars resorts
- Prime Ministers of the United Kingdom
- Furries
- Property
- Film
- Users
- My butt hurts from sitting here
- Cities in the United Kingdom
- Corporate
- Spanish
- Computer graphics
- Hey, I was looking at that naked lady!
- Squamata
- Quiet
- Pages That Suck
- I spent ages on this and all I got was this stupid t-shirt
- Diseased Pages
- Gasp
- Funny
- Food related cloud patterns
- Containers
- Viruses
- References
- Condiments
- Stinky
- Sound advice
- Axis of evil
- Mexicans
- Fundaments of Illogic
- Video games consoles
- Brazil
- Possibly vanity?
- Unrealistic
- Categories that clash
- Articles in which the thing that the preceeding category pointed out has been rectified, making both that category and this one rather redundant
- Sensible people
- Awards
- Articles that link to Doom.org
- ?labs
- Eunuchs
- Palindromes
- Semi-Logical
- Smoking
- Languages of the United Kingdom
- Groanworthy
- Artciles that haven't had a "definitive category" added to them resulkting in the application of this silly category
- Ethics
- Song reviews
- Articles that seem to have misunderstood their title and gon off on a complete tangent
- Whoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooaaaaaaaaaaaaaaaaaaaaaaaaaaaa
- Travel pondy
- Indecent
- Iceland
- Predictions
- 16...16
- Jehovah's Witnesses
- Unwitting participants of The Shuriken-Ninja sex scandal
- Chivalry
- American television people
- Business
- Camp. Oh so very camp
- The Marx Brothers
- Stolen goods
- Thank you US Army
- Pages that change upon clicking the sexy refresh button
- Marine mammals
- Gases
- Beaten up user
- (sigh)
- Interrup-EEBLESONK-ting
- Pointless
- Cliffhangers
- Skellingtons
- Oceans
- What was he smoking?
- Illogicopedians on the No Fly List
- Poverty
- Lies about what it says on the tin
- Articles that have been written by a devout sexist (HelloolleH)
- Not Chevy
- Department of Limelight/Award
- Indeed
- E---- 2 gg 77
- Plays
- Emblems
- Islandzalienksruwep
- Articulartastic Ministry for Articles/Help
- 1973 births
- Users that got blocked by Hindleyite
- Primates
- Copyedited images
- Greek lepers
- Users who have categories on their userpage not added by them
- Users whose mind is permanantly fixated on the lower end of the male body... slightly suspiciously
- Users whose familys' cause of death is "Got in my way"
- Major Lee POV
- Mouldy
- Users who have more categories than articles (and that's saying something for Testostereich)
- Moon phases
- Phobias
- Theoptiongame
- Cows
- Articles with this very unimaginative category
- Oh dear
- Far out Huge bob doodlings
- Snookums
- If you're in the hallway, can you turn that light off?
- Profane
- Controversial
- References to Metal Gear Solid
- Code
- Fairy stories
- Illogimusic
- Scottish
- FOR FUCKS SAKE!!! USE THE LOWER CASE
- Architecture
- Pets
- Radio
- Sexy
- Illogicopedia user groups
- Weasels
- Bad child's
- Admins
- HAGGER?
- Animations
- Murder
- Something that in itself is something
- Necessary
- Mint
- Grand Theft Auto Illogicopedia
- Russia
- Deaf
- WTFIGO
- Beans on toast
- Beans
- The Simpsons
- ¬ ¬
- My brain hurts
- Games Consoles
- Orgasmic
- Cursed
- Boo hoo
- Non-racist articles
- Citizens of Subbuteo
- Sickle
- Eeeehhhh...PAGE
- SPIFF!
- List lists
- Silly
- Uncyclopedia CVP articles
- (insert insane guitar riff here)
- Stitches in time
- Things that are plod
- Winthorpe
- Sausages
- Spoofs
- Social status
- Tedious pop culture references
- Tomorrow
- The Matrix
- Articles based on the elusive Sepmiester
- Fruity
- Oh dear God
- Interspecies fondling
- Signs
- Chin-strokers
- Leeched from Micropedia
- Adventures
- Too much information
- Evil Robot Clones
- Public Domain images
- Softball
- If badly prepared will result in death
- Dude
- Flooded Pages
- World maps
- Management Templates
- Religous
- Wanted Users
- The Professionals
- Libras
- Users, seeing the numerous categories added to their userpage during their abcense from the site, decide to retaliate agaist the soundrel by creating this category. Take that
- Users who may or may not have mysteriously disapeared after key world events and resurfaced under a different name
- The Illogicrats
- References to Alice's Adventures in Wonderland
- Candidates for Limelight/Featured
- User page templates
- Semantics
- Users that hate Ryan
- Candidates for Limelight/Failed
- Electricity
- Essence of The Sex
- Articles with unsourced statements
- No Scope
- Gambling
- Sectional templates
- Not particularly epic, yet not strongly anti-epic either
- Comedy
- Off Tropic
- Language unknown
- Users who have at some point eaten a hot dog with extra onions
- Banners
- Politics of the United Kingdom
- Users obsessed with the word sherb
- Users who aren't Testostereich
- Immature
- Creative Commons images
- We Are CI2
- Users who are members of the Order of the Paperclip, Second Class
- PhyllogiMusic
- Nintendo
- Brass
- Books
- Lovely jubbly
- Tasty
- Paradox
- Petroleum products
- Inhabitants of Poirot's moustache
- Fluffy
- The world thru my eyes, none?! yes, no? who wat ware? FOOOOOPPP
- Emo
- Supernatural phenomena
- Super Japan
- Photography
- IStuff
- Bears
- Ok?
- Home invasion
- Whee
- Clever plots to destroy the world
- Flags
- Cigarettes
- Parties
- Linux
- Continents
- Emotions
- Musical instruments
- Australia
- Orthography
- Monster mash
- References to Monty Python
- Think I'm gonna be sick
- Huh?
- Me
- Yaks
- The Best Article Ever!
- Pages with no categories
- Benefit fraud
- Jews
- Articles that probably won't be understood by most
- Things that will hurt you
- Guinness World Records
- Fathers
- Godson
- Things that won't hurt you
- Attempted memes, please no more (lol)
- Heedlespumfulators
- The Longwinded Quest
- WackyBooks
- Catergory:Users who don't spend enough time on their userpage and wish they did
- Yay!
- Plainswept winds
- Users who don't spend enough time on their userpage and wish they did
- IllogiQuotes
- Users who are under the impression that hot dogs were actually fried poodles
- Badges
- Clowns
- T3canolis user pages
- Disambiguation pages
- Electronics
- Cooking
- Highly vandalised pages
- Move to Uncyclopedia
- Users who are members of the Order of the Paperclip, First Class
- Enter the Realm 2
- Used unused images
- Lego
- Cartography
- Asdf
- Foreladies
- Kazakh television people
- Sorority members
- Welcoming committee members
- Userboxes
- Liberapedia
- Gary Numan
- Communism
- Dinosaurs
- Sweet
- EPIC
- Zombies
- Ba doo ba doo
- Buttons
- Stereotyping
- Kate McAuliffe
- Perplexing
- Illogiscape
- Top secret
- Language
- Europe
- People for whom Quotes are Made
- McDonald's
- Confusing, but sounds scientific
- Television programmes
- Useless
- Sinister
- BLARG
- EVIL!!!!! - according to liberapedia
- WTF is that
- Increasingly insane
- Reptiles
- Salty
- Sick
- Doom
- Warning signs
- Beat the Dog to the Window
- Grids of War
- Cricket
- Quaint
- Articles that may be living in a yellow submarine
- Climatic
- Asia
- Christmas Rockin' Article Pursuit
- Mexico
- Articles with a category that point out the category to the left of it does not suit the article at all, not one bit
- Nothing to do with Francis Bacon
- Sensible articles
- Logos
- Suicide
- ORLY?
- Ay caramba!
- Fackin slaeg
- I think therefore I am an oyster
- This
- This is a category, but it shouldn't be a category because it's a ridiculous name for a category and it's too long
- Siamese Articles
- Comic Strips
- Stuff I made up just now
- Rokkin
- I pledge a legion
- Astrology
- Hark! I hear Iran firing its missiles!
- Articles with lots of random celebrities
- Not even pseudo science
- Great Brits
- Users that want to be an admin and think they'd be good on the fact that they have no life
- Articles of faith
- Godmothers
- Illogicopedia Club card members
- Or
- GNU images
- Uncategorised pages LOL
- Candidates for Limelight/Archive
- Office work
- Infinite loop III
- Users who because of a small virtual award, have now been proved wprthy by Flub Nugget
- Spontaneity
- Welcome Templates
- Icons
- Users who have more categories than sense
- Msn
- Praised User
- Users who lack the inspiration to give themself a more inspirational category
- Popcorn Series
- Users who may or may not be users
- Requests for unblock
- Unruly
- Industry
- Wikia screenshots
- Stamps
- Approved by Kansas Board of Education
- References to The Matrix
- Geography of the United Kingdom
- Users with almost as many categories as gold stars
- Articles that are afraid of Virginia Woolfe
- Users who have a copy of the sex offenders' list
- Cultural conventions
- Images
- Users who can only think of making articles that repeat a certain name
- Users who make other users say "OMGWTF" for no apparent reason
- Users who are chained to Ryan's bedpost
- Infinite loops
- Etiquette
- Lesser Spotted Bingham
- Logical Sector
- Articulartistic Ministry for Articles
- Ideas
- Articles that will probably never be finished
- Charlie The Unicorn Fans
- Pie Clan
- Stub templates
- Drug user
- Stranger than friction
- The Strangled Cat Party
- Maps
- Users of whom it is alleged falsely that they play runescape
- Usfers tat cqant spllllll n e tyhng
|